PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG564100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25940.8 Da    PI: 9.1294
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG564100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.69.2e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien + rqvtfskRrng+lKKA+ELSvLCdaeva++++s++gklye++s
  Pavir.9KG564100.2.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVVISPRGKLYEFAS 59
                         79***********************************************86 PP

2K-box69.41.1e-2378171699
                K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                          ++++++++ e+ + +++ L k++e L+  +R+llGe+Le++s++eL++Le +Leksl  iR +K++ll eq+++l+++e  l+++n++Lr
  Pavir.9KG564100.2.p  78 SSKTAQQDIEQVKADAEGLAKKLEALEAYKRKLLGEKLEECSIEELHSLEVKLEKSLHCIRGRKTQLLEEQVNKLKEMEMTLRKNNEELR 167
                          333788999********************************************************************************* PP

                K-box  96 kkle 99 
                          +k +
  Pavir.9KG564100.2.p 168 EKCK 171
                          *976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.16161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-32381IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002654.30E-42378No hitNo description
PRINTSPR004044.5E-30323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-2482171IPR002487Transcription factor, K-box
PROSITE profilePS5129713.36686176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALVVISP RGKLYEFASA  60
SVQKTIERYR TYTKDNASSK TAQQDIEQVK ADAEGLAKKL EALEAYKRKL LGEKLEECSI  120
EELHSLEVKL EKSLHCIRGR KTQLLEEQVN KLKEMEMTLR KNNEELREKC KNQPPLPLTP  180
ARPVITVEDD RPEQNDDDRM DVETELYLGL PGRDPRRNKV AEVRSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D3e-18372271Myocyte-specific enhancer factor 2A
3mu6_C3e-18372271Myocyte-specific enhancer factor 2A
3mu6_B3e-18372271Myocyte-specific enhancer factor 2A
3mu6_A3e-18372271Myocyte-specific enhancer factor 2A
1egw_D3e-18378277MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-18378277MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-18378277MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-18378277MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J4e-18372271Myocyte-specific enhancer factor 2A
3p57_I4e-18372271Myocyte-specific enhancer factor 2A
3p57_D4e-18372271Myocyte-specific enhancer factor 2A
3p57_C4e-18372271Myocyte-specific enhancer factor 2A
3p57_B4e-18372271Myocyte-specific enhancer factor 2A
3p57_A4e-18372271Myocyte-specific enhancer factor 2A
3kov_J4e-18372271Myocyte-specific enhancer factor 2A
3kov_I4e-18372271Myocyte-specific enhancer factor 2A
3kov_B4e-18372271Myocyte-specific enhancer factor 2A
3kov_A4e-18372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.34880.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9607740.0EU960774.1 Zea mays clone 228490 MADS-box transcription factor 56 mRNA, complete cds.
GenBankEU9625040.0EU962504.1 Zea mays clone 243238 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985920.11e-142PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_012698462.11e-142PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_004985919.11e-142PREDICTED: MADS-box transcription factor 50 isoform X2
SwissprotQ9XJ601e-120MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLC5X0V91e-126C5X0V9_SORBI; Putative uncharacterized protein Sb01g049020
STRINGSb01g049020.11e-125(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.17e-74AGAMOUS-like 20